PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa02g007650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 515aa    MW: 57618.6 Da    PI: 7.7875
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa02g007650.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.7e-182479257
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    +kR   t+ q+ +Le+++++++yp++e++ +LA+++gLte+qV+ WF+ rR k+k+
  Csa02g007650.1 24 KKRKLKTPIQVMTLENFYNEHKYPTEEMKGKLAEEIGLTEKQVSGWFCHRRLKDKR 79
                    8999**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-191079IPR009057Homeodomain-like
PROSITE profilePS5007116.5842080IPR001356Homeobox domain
SuperFamilySSF466898.13E-172286IPR009057Homeodomain-like
SMARTSM003891.1E-182284IPR001356Homeobox domain
CDDcd000861.20E-162480No hitNo description
PfamPF000461.7E-152479IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MCSFLTDSGE APADGDKAST ENSKKRKLKT PIQVMTLENF YNEHKYPTEE MKGKLAEEIG  60
LTEKQVSGWF CHRRLKDKRS VKEDGTNIGS QDRSSIVLQD RGSGLRQDSC GSTKQTDYWN  120
TKPREVESQR LYGGSYMGNA DGEDSTSSER SSSLHKNLVS SKDGIRDVES SRYVTHNDVI  180
QHPHVMRSYE YKKPSGYLKV KRASENVSIT AVKRQLGRQY QEDGPPLGIQ FDPLPPGAFE  240
PQTNAIVQEP IYVGNQRRPH PPHLLGTRKS FNPGPSYELT RKLKMHSPDP DSEEEEEDDD  300
NIMIGMEPGL RDRKSLGEPR LKSPSPSFYN TVPNHKPFQE TFNGSPRELP VTNNKKGRIS  360
SKSWAEGSRN NMIANFDNLP GNNIKTNQTH NYDKKIFNGG HKTGYLTKSS KLLPPSRSRS  420
PDSIDRGPSS VMAGKFHGER NQTITHREKL HSTDEPLVTK RVKDGYLQQD YAPKSSYSEI  480
LEREGQINGS GVELASSLSG DDDETDESSS SSMD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010430803.10.0PREDICTED: uncharacterized protein LOC104715048
TrEMBLR0HBG10.0R0HBG1_9BRAS; Uncharacterized protein
STRINGAT4G03250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122022531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.10.0HB-other family protein